PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00291.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 391aa    MW: 43512.1 Da    PI: 9.1405
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00291.1_g00009.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.61.4e-38125184261
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                              ++k+l+cprC+s+ntkfCyynny++sqPryfC++C+ryWt+GG++rnvPvG+grrknk +
  Rsa1.0_00291.1_g00009.1 125 PDKILPCPRCESANTKFCYYNNYNVSQPRYFCRNCQRYWTAGGSMRNVPVGSGRRKNKGW 184
                              7899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-29122182IPR003851Zinc finger, Dof-type
PfamPF027018.0E-32127182IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.546129183IPR003851Zinc finger, Dof-type
PROSITE patternPS013610131167IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MSKSRDTEIK LFGRTITSLV AVNHYDPSPL STAHGGSDQS KEASSSSSSS CSPFIRPDRV  60
FADKNEKENS RFKDPYTLSH LNEPPKAASE ILSPISSKTN TDQQSEITTT TSTSAADKHT  120
TLKKPDKILP CPRCESANTK FCYYNNYNVS QPRYFCRNCQ RYWTAGGSMR NVPVGSGRRK  180
NKGWPSSNHY LHVTSEDYEN NNNNSGTILS FGSLESSVTE TGKHQPGDTK IISDSAPQEQ  240
KTRQGFLPPQ VMFANNSSPW PYSHQWSPTG PNANFYPIPF YWGCTVPIWP TSETPPCLGK  300
RSRDQTEGGI KEATTITTSR LVSESLSIKE ANKTAVWSTK PERKTEGFNL FDGFETKRSN  360
GRSLVPETSI NLQANPAAMS RSMNFRENIQ Q
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00223DAPTransfer from AT1G69570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013588706.10.0PREDICTED: cyclic dof factor 5-like
SwissprotQ9SEZ30.0CDF5_ARATH; Cyclic dof factor 5
TrEMBLA0A0D3CXN10.0A0A0D3CXN1_BRAOL; Uncharacterized protein
STRINGBra003994.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM130901729
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69570.11e-179Dof family protein